Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha (FCER1A), partial

In Stock
Code CSB-EP008532HU
Abbreviation Recombinant Human FCER1A protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Fc epsilon RI alpha; Fc epsilon RI alpha chain ; Fc epsilon RI alpha-chain; Fc fragment of IgE high affinity I receptor for alpha polypeptide; Fc fragment of IgE; high affinity I; receptor for; alpha subunit; Fc fragment of IgE; high affinity I; receptor for; alpha polypeptide; Fc IgE receptor alpha polypeptide; Fc IgE receptor; alpha chain; Fc IgE receptor; alpha polypeptide; Fc of IgE high affinity I receptor for alpha polypeptide; Fc-epsilon RI-alpha; FCE 1A; FCE1A; FCER 1A; Fcer1a; FCERA_HUMAN; FceRI alpha; FcERI; high affinity IgE receptor; High affinity immunoglobulin epsilon receptor alpha subunit; high affinity immunoglobulin epsilon receptor alpha-subunit; High affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor alpha subunit; IgE Fc receptor subunit alpha; Immunoglobulin E receptor high affinity of mast cells alpha polypeptide ; immunoglobulin E receptor; high-affinity; of mast cells; alpha polypeptide
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-205aa
Target Protein Sequence
VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.0kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of this Recombinant Human FCER1A protein required the insertion of a DNA fragment (FCER1A, 26-205aa) into a plasmid vector and the transferral of this vector into E.coli cells (the step of transformation). The cells were then cultured and induced to express the FCER1A protein. This recombinant protein was fused with N-terminal 6xHis-SUMO tag. Its purity is 90%+ determined by SDS-PAGE.

FCER1A (also known as FCE1A) is a gene providing an instruction of making a protein named high affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) in human. FCER1A protein is also known as Fc-epsilon RI-alpha (FcERI) and IgE Fc receptor subunit alpha. This protein is a component of immunoglobulin epsilon receptor (IgE receptor), which is comprised of an alpha subunit, a beta subunit, and two gamma subunits. IgE receptor is the initiator of the allergic response by binding to the Fc region of immunoglobulins epsilon.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Gene References into Functions
  1. Patient stratification revealed a significant association (P < 0.05) of rs2427827 SNP with high IgE level Chronic Rhinosinusitis with Nasal Polyposis (CRSwNP) patients. Nonetheless, we found no SNP associated with low serum IgE level patients. SNP (rs2427827) in the FcvarepsilonR1alpha gene region and high IgE levels may confer susceptibility to CRSwNP in north Indian population. PMID: 29243845
  2. Data show that each IgE Fc is targeted by two single-domain antibodies (sdabs) having an epitope largely distinct from the FcepsilonRI binding site but overlapping significantly with the CD23-binding site. PMID: 29295972
  3. Autoreactive CD4(+) T cells that target FcepsilonRIalpha were detected in most subjects with chronic spontaneous urticaria, with a cytokine secretion profile more typical of a TH1-cell response. Our findings suggest that measurement of T-cell as well as autoantibody responses to FcepsilonRIalpha could improve diagnostic accuracy in subjects with chronic spontaneous urticaria . PMID: 27417022
  4. Our results suggest that IL13 rs20541, IL4 rs2243250, ADRB2 rs1042713, and FCER1B rs569108, four SNPs with significant sole effect on asthma, interact to confer a higher risk for the disease in Chinese Han children. PMID: 26613553
  5. F-AFE containing anti-allergic phytochemicals, including arctigenin, inhibited the activation of the FceRI receptor induced by the antigenIgE complex PMID: 26707911
  6. IgG2 and IgG3 are involved in recruiting CD32 to inhibit activation of FcepsilonRI in human basophils. PMID: 26774660
  7. Asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) Fc epsilon RI(+) blood mast cell progenitors than asthmatics with normal lung function. PMID: 26626992
  8. SNPs of FcepsilonR1alpha promoter region may be used as disease markers for IgE-mediated allergic inflammation caused by Dermatophagoides pteronyssinus. PMID: 25923080
  9. FcepsilonRI alpha-chain is an activating platelet endothelium aggregation receptor 1 (PEAR1) ligand. PMID: 25713122
  10. Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation PMID: 26136426
  11. These data suggest that rs2298805 might be associated with risk for Chronic urticaria and the therapeutic efficacy of nonsedating H1-antihistamines in Chinese patients PMID: 25412950
  12. FCER2 polymorphism rs3760687 affects moderately elevated total serum IgE levels, especially in the absence of homozygosity for the risk allele of FCER1A SNP rs2427837. PMID: 24354852
  13. Data indicate that antigen (Ag) targeting to FcepsilonRI inhibits the development of Ag-specific T cell immunity and induces T cell tolerance. PMID: 24610015
  14. FCER1A expressing dendritic cells and monocytes but not basophils, significantly contribute to serum hIgE clearance. PMID: 24569373
  15. elevated levels of surface-bound proteins on cord blood basophils is associated with maternal allergy PMID: 23980848
  16. Genetic polymorphism is associated with IgE levels in asthmatics in Germany PMID: 23725541
  17. Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation. PMID: 24361879
  18. We assayed the genotype and allele frequencies of rs2298804 (251 A>G) in the FCER1A gene, in patients with Systemic Lupus Erythematosus in a Chinese Han population and found a significant difference for both the AG genotype and the G allele PMID: 23621092
  19. no association between SNP in the FCER1A gene region and serum total IgE level in Chinese allergic rhinitis patients PMID: 22800345
  20. Expression of high-affinity IgE receptor on human peripheral blood dendritic cells in children PMID: 22384272
  21. Mutation in IgE receptor is associated with mast-cell leukemia. PMID: 22173243
  22. Linkage disequilibrium and the distribution of haplotypes for two identified human FCER1A 3'-UTR polymorphisms and several previously reported 5'-flanking region and 5'-UTR variants in Japanese and Poles, is described. PMID: 21725845
  23. genetic polymorphisms in the promoter region is associated with atopic dermatitis in a Han Chinese population PMID: 22222815
  24. increased FcepsilonRI expression on alveolar mast cells is a novel disease-specific feature of allergic asthma. PMID: 21958156
  25. Data show that the developed method allows for comparative analysis of sFcepsilonRI levels in health and disease. PMID: 21903095
  26. There were no significant relationships between FcepsilonRI and atopic dermatitis, although there were trends towards an association between the 66T>C (rs2251746) polymorphism and total serum IgE levels. PMID: 21738338
  27. FcepsilonRI transgene on dendritic cells drives the cascade of pathogenic reactions linking the initial allergen capture by IgE with subsequent T helper (Th)2-dominated T cell responses and the development of late-phase allergic tissue inflammation. PMID: 21622859
  28. The crystal structure of IgE bound to FcepsilonRI is determined. PMID: 21516097
  29. SNPs in the FCER1A gene region show no association with allergic rhinitis in a Han Chinese population PMID: 21209833
  30. Data indicate that although results rather show the lack of an association between FCER1A rs41264475 mutation and atopic dermatitis, they suggest that its minor allele can predispose to the concomitant asthma in AD patients. PMID: 21216468
  31. The ability of four synthetic and sequence-specific RNA interfering antisense oligodeoxynucleotides (AS-ODNs) to reduce the expression of FcepsilonRIalpha gene in granulocytes of allergy sufferers in vitro, was investigated. PMID: 19697153
  32. Secretagogue stimulation results in an increase in the immature p46 form of FcepsilonRIalpha due to reversal of degradative pathways rather than increased synthesis of FcepsilonRIalpha. PMID: 20664273
  33. FCER1A variants by themselves and in combination influence IgE levels and act synergistically to influence eczema risk. PMID: 20028371
  34. Data suggest a contribution of Fc epsilonRI alpha and gamma chains either to immunosurveillance or pathophysiology of the intestinal epithelium. PMID: 20126404
  35. FcRIalpha gene variants are involved in the pathogenesis of IBD. PMID: 20163202
  36. Data show that atopic dermatitis patients with the FCER1A -315CT/TT genotype tended to have higher total serum IgE levels. PMID: 20141544
  37. Glucose can augment Fc epsilon RI-mediated mast cell activation, particularly the degranulation response and LTC(4) secretion after prolonged culture of mast cells with high-glucose medium. PMID: 20523060
  38. counterregulation of FcepsilonRI and TLR-7 pathways exists in Plasmacytoid dendritic cells PMID: 20410486
  39. genetic polymorphismn, mutational screening and asthma association studies; review PMID: 18726713
  40. SP downregulated expression of FcepsilonRI in a concentration dependent manner; the effect was mediated by the neurokinin-1 receptor and resulted in reduced mast cell activation. PMID: 20117843
  41. Expression of FcepsilonRI was significantly elevated on respiratory tract dendritic cells (RTDC) from atopic as compared to nonatopic patients. PMID: 19385959
  42. homozygosity for the C allele of FcepsilonRI alpha chain variant is associated with lower IgE levels PMID: 12070183
  43. Regulation of FcepsilonRI-mediated degranulation by an adaptor protein 3BP2 in rat basophilic leukemia RBL-2H3 cells. PMID: 12200378
  44. Transcriptional regulation of the high affinity IgE receptor alpha-chain gene. PMID: 12217383
  45. Efficient folding of the FcepsilonRI alpha-chain membrane-proximal domain D2 depends on the presence of the N-terminal domain D1. PMID: 12270716
  46. mast cells modulate the immune system following TLR4-mediated activation and FcepsilonRI aggregation PMID: 12855579
  47. In clinically uninvolved skin, Langerhans' cell-surface Fc epsilon RI expression is not only linked to atopic dermatitis but is also generally associated with allergic disease. PMID: 12897750
  48. T/C polymorphism in Fc epsilon RI alpha-chain promoter at nucleotide position -66 is associated with allergic diseases in a Japanese population. PMID: 12902495
  49. Fc epsilon RI-mediated calcium flux (dependent on PLC gamma 1) leads to degranulation of mast cells independent of PI 3-kinase PMID: 13129935
  50. Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells. PMID: 14746805

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links

HGNC: 3609

OMIM: 147140

KEGG: hsa:2205

STRING: 9606.ENSP00000357097

UniGene: Hs.897

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*